PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00123512001
Common NameGSBRNA2T00123512001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 280aa    MW: 31366.1 Da    PI: 8.1796
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00123512001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.71.1e-3742100260
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                          +++ ++cprC+s+ntkfCyynnysl+qPry+Ck+CrryWt+GG+lrnvPvGgg+rknkk
  GSBRNA2T00123512001  42 PQELRNCPRCNSSNTKFCYYNNYSLAQPRYLCKSCRRYWTEGGSLRNVPVGGGSRKNKK 100
                          67889****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-274198IPR003851Zinc finger, Dof-type
PfamPF027014.1E-3344100IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.44446100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDHHHYTHHD HDQYQHHQMT ITNNNPYNTI ITTPPPSKQH RPQELRNCPR CNSSNTKFCY  60
YNNYSLAQPR YLCKSCRRYW TEGGSLRNVP VGGGSRKNKK LPLLQPNSSS SSPAKNLPDL  120
NPPFAFTSSS STSTSSNPSK SAHRNNNDLS LSFSYPTMQE DKRAQGHYGH FTEQAMSGGQ  180
NCLFAAPMGM IQFRQDYGHD HNNTDIGFSL DSNKVDSNNQ NNLLVNGGGS KLMFSYGDRD  240
EHHHDHERHD DGNKKRESGS SNELWSGIIL GGDSGGPTW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607240.11e-160PREDICTED: dof zinc finger protein DOF4.1
RefseqXP_013607241.11e-160PREDICTED: dof zinc finger protein DOF4.1
SwissprotQ9M1611e-121DOF41_ARATH; Dof zinc finger protein DOF4.1
TrEMBLA0A078F1950.0A0A078F195_BRANA; BnaCnng01710D protein
STRINGBra037401.1-P1e-143(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM146951720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00940.11e-95Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]